PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009617198.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 249aa    MW: 27513.7 Da    PI: 9.2831
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009617198.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.12.1e-31168224158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep++VNaKQy++Il+RR++Rak+e ekkl +k rkpylheSRh+hAl+R+R+sgGrF
  XP_009617198.1 168 QEPVFVNAKQYHGILRRRESRAKAELEKKL-IKVRKPYLHESRHQHALKRARASGGRF 224
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-34166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.027167227IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-26169224IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.0E-22170192IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860172192IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.0E-22201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MQSKSKSVNC GEARTYNVPN SIVYSEPWWN TAGYNPVSLG SMRGSASDSS SREQSVDGRS  60
QSDGRANEED DDAPEKSQST IHMHSDGERS YPQVQNLQPV ASTIPPKGDG SQTQPRQLEL  120
VTHSIACAPN LYADPYYGGM MTPFGQPMVP HVLDMHHLRM PLPHEMAQEP VFVNAKQYHG  180
ILRRRESRAK AELEKKLIKV RKPYLHESRH QHALKRARAS GGRFAKKSNT DTSKGTCSGS  240
GSNPDLSAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-18168232266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617198.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_009617197.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_009617196.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
TrEMBLM1AQ621e-139M1AQ62_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000277851e-138(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.42e-50nuclear factor Y, subunit A1